PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_13038A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 269aa    MW: 27444.7 Da    PI: 7.8629
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_13038AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.93.4e-4338136199
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq
  Oropetium_20150105_13038A  38 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPFQREDAVNSLAYEADMRLRDPVYGCVGVISILQ 121
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallke 99 
                                ++l+ql+++la++k 
  Oropetium_20150105_13038A 122 HNLRQLQQDLARAKY 136
                                **********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.72937138IPR004883Lateral organ boundaries, LOB
PfamPF031954.4E-4338134IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MASSSASSMP PAPSGSVITV ASSSSSAAAA AVCGTGSPCA ACKFLRRKCQ PDCVFAPYFP  60
PDNPQKFVHV HRVFGASNVT KLLNELHPFQ REDAVNSLAY EADMRLRDPV YGCVGVISIL  120
QHNLRQLQQD LARAKYELSK YQAAAAAAAS ASTGPNGQQA MAEFIGNGGG MPNGGGHNFI  180
HSSALGSIGV FGGAGQDHHF SSNAQMLSRG YDGTEPIARL GINGGYEFGY STTMGGPGGP  240
VPGLGTLGVS SFLKSGTAGG DEKPSTGQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9406811e-152AY940681.1 Zea mays ASYMMETRIC LEAVES2 mRNA, complete cds.
GenBankEU9660921e-152EU966092.1 Zea mays clone 291632 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970852.11e-140PREDICTED: LOB domain-containing protein 6
SwissprotQ32SG31e-136LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLK3XL261e-140K3XL26_SETIT; Uncharacterized protein
STRINGSi002599m1e-139(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.41e-58LBD family protein